PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G114900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 292aa    MW: 31543.4 Da    PI: 4.8055
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G114900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.9e-151461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  Sevir.4G114900.1.p 14 KGPWTAEEDQKLVGFLLTHGHCCWRIVPKLAGLLRCGKSCRLRWTNYL 61
                        79******************************99************97 PP

2Myb_DNA-binding51.52.3e-1667111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg  + +E+ l +d++ qlG++ W++Ia++++ gRt++++k++w+++
  Sevir.4G114900.1.p  67 RGVLSDDEERLVIDLHGQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                         677799****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-20562IPR009057Homeodomain-like
PROSITE profilePS5129413.561961IPR017930Myb domain
SuperFamilySSF466899.73E-2711108IPR009057Homeodomain-like
SMARTSM007175.1E-111363IPR001005SANT/Myb domain
PfamPF002493.3E-131461IPR001005SANT/Myb domain
CDDcd001671.20E-81661No hitNo description
PROSITE profilePS5129426.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2363116IPR009057Homeodomain-like
SMARTSM007177.9E-1566114IPR001005SANT/Myb domain
PfamPF002495.0E-1467111IPR001005SANT/Myb domain
CDDcd001671.21E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGRQPCCDKV GVKKGPWTAE EDQKLVGFLL THGHCCWRIV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGVL SDDEERLVID LHGQLGNRWS KIAARLPGRT DNEIKNHWNT HIRKKLLRMG  120
IDPVTHLPLQ EAPAPPPQEQ QEDQPPPAPQ QQQQPPQPQE HHQPRNDSGL MLQDDDAGEE  180
DLPMFQPHEV ATAPPAPPTA AAAAVSNCGS VSSASAGSVS VVSPSCSSSA SAPAASGVEA  240
TEWPEPMYLF GMDDGIIDAG CWDGLFPGGG MGVDPFDGYP GGGFDQDDDW L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0375371e-174BT037537.1 Zea mays full-length cDNA clone ZM_BFb0176M23 mRNA, complete cds.
GenBankEU9518731e-174EU951873.1 Zea mays clone 1061835 odorant 1 protein mRNA, complete cds.
GenBankJX4699451e-174JX469945.1 Zea mays subsp. mays clone UT3206 MYB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965175.11e-154PREDICTED: protein ODORANT1-like
SwissprotQ50EX63e-84ODO1_PETHY; Protein ODORANT1
TrEMBLK3XYK91e-154K3XYK9_SETIT; Uncharacterized protein
STRINGSi007017m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.16e-77myb domain protein 20